Protein Info for RR42_RS02010 in Cupriavidus basilensis FW507-4G11

Annotation: 50S ribosomal protein L25

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 PF01386: Ribosomal_L25p" amino acids 5 to 90 (86 residues), 85.5 bits, see alignment E=2.9e-28 TIGR00731: ribosomal protein bL25, Ctc-form" amino acids 6 to 175 (170 residues), 146.2 bits, see alignment E=4.2e-47 PF14693: Ribosomal_TL5_C" amino acids 98 to 185 (88 residues), 103.5 bits, see alignment E=6.5e-34

Best Hits

Swiss-Prot: 88% identical to RL25_CUPTR: 50S ribosomal protein L25 (rplY) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K02897, large subunit ribosomal protein L25 (inferred from 88% identity to cti:RALTA_A0316)

Predicted SEED Role

"LSU ribosomal protein L25p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y6Q9 at UniProt or InterPro

Protein Sequence (200 amino acids)

>RR42_RS02010 50S ribosomal protein L25 (Cupriavidus basilensis FW507-4G11)
MKVVAFERSVQGTGASRRLRNAGKTPGIIYGGAAEPKMIELDHNALFHALKKEAFHSSIL
DIEVEGKAEKALLRAFQMHPFKPLVLHVDFQRVSATDKIHVKVPLHFMNQENAPGVKLGH
GIVNHILNELEVSCLPADLPEFIEVDLSNAELGQTLHLSDVKLPKGVSAITHGDENPAIA
SISLPAGGVSEAAEGETPAA