Protein Info for RR42_RS01990 in Cupriavidus basilensis FW507-4G11

Annotation: methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 PF03602: Cons_hypoth95" amino acids 1 to 174 (174 residues), 159 bits, see alignment E=3.3e-50 TIGR00095: 16S rRNA (guanine(966)-N(2))-methyltransferase RsmD" amino acids 2 to 175 (174 residues), 144.4 bits, see alignment E=1.7e-46 PF05175: MTS" amino acids 29 to 120 (92 residues), 32.9 bits, see alignment E=1.5e-11 PF13847: Methyltransf_31" amino acids 38 to 144 (107 residues), 32.5 bits, see alignment E=2.1e-11 PF13649: Methyltransf_25" amino acids 43 to 137 (95 residues), 38.3 bits, see alignment E=5.3e-13 PF08241: Methyltransf_11" amino acids 43 to 140 (98 residues), 29 bits, see alignment E=4.2e-10 PF13578: Methyltransf_24" amino acids 56 to 140 (85 residues), 27.4 bits, see alignment E=1.6e-09

Best Hits

KEGG orthology group: None (inferred from 86% identity to rme:Rmet_0284)

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase D (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>RR42_RS01990 methyltransferase (Cupriavidus basilensis FW507-4G11)
MGGKWKRTPLPVLDAEGLRPTPDRVRETLFNWLGQDMSGLACLDLFAGSGALGFEAASRG
ARQVTMVEANPRVAKQLRDNQYRLDAQQIRVVQGDAFATAAQMPSASFDVVFLDPPFAED
WLGPALEHAARLSRPGGAVYVETDRALIGPDAPVPAALEIVRHARAGAVHFHLLQHRNL