Protein Info for RR42_RS01975 in Cupriavidus basilensis FW507-4G11

Annotation: cell division protein FtsY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 381 PF02881: SRP54_N" amino acids 101 to 161 (61 residues), 47.7 bits, see alignment E=2.1e-16 TIGR00064: signal recognition particle-docking protein FtsY" amino acids 110 to 379 (270 residues), 338.5 bits, see alignment E=1.4e-105 PF06414: Zeta_toxin" amino acids 175 to 286 (112 residues), 28.7 bits, see alignment E=1.2e-10 PF00448: SRP54" amino acids 182 to 380 (199 residues), 237.5 bits, see alignment E=1.6e-74

Best Hits

KEGG orthology group: K03110, fused signal recognition particle receptor (inferred from 84% identity to cti:RALTA_A0308)

Predicted SEED Role

"Signal recognition particle receptor protein FtsY (=alpha subunit) (TC 3.A.5.1.1)" in subsystem Bacterial Cell Division or Two cell division clusters relating to chromosome partitioning or Universal GTPases (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4XZ70 at UniProt or InterPro

Protein Sequence (381 amino acids)

>RR42_RS01975 cell division protein FtsY (Cupriavidus basilensis FW507-4G11)
MFSFWKKRKAEPASAPPEVQSPAPAATPAAAPASVPPPIPAAAPAPATVVPVTPTASQPV
RSATPAAAEELVLTPPPAASAEAKRGWMQRLRTGLSKTSRNLGTLFVGVKVDEDLFEDLE
TALIMADAGVEATQHLLSALRRRVKTERIETAEGVKAALRELLTDLLRPLEKTMSLGREQ
PLVMMISGVNGAGKTTSIGKLCKHFQSYDQSVLLAAGDTFRAAAREQLTIWGERNNVTVV
SQESGDPAAVIFDAVNAARARGIDIVMADTAGRLPTQLHLMEELKKVKRVIAKAMPNAPH
ESLLVIDANTGQNALSQVKAFDDALGLTGLIVTKLDGTAKGGILAAIARQRPVPVYFIGV
GEKVEDLQPFKAEEFADAVLG