Protein Info for RR42_RS01920 in Cupriavidus basilensis FW507-4G11

Annotation: protoheme IX farnesyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 transmembrane" amino acids 35 to 54 (20 residues), see Phobius details amino acids 60 to 81 (22 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 157 to 177 (21 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 225 to 246 (22 residues), see Phobius details amino acids 252 to 271 (20 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details TIGR01473: protoheme IX farnesyltransferase" amino acids 26 to 303 (278 residues), 296.5 bits, see alignment E=1.3e-92 PF01040: UbiA" amino acids 39 to 287 (249 residues), 219.5 bits, see alignment E=2.3e-69

Best Hits

Swiss-Prot: 92% identical to COXX_CUPTR: Protoheme IX farnesyltransferase (ctaB) from Cupriavidus taiwanensis (strain DSM 17343 / BCRC 17206 / CIP 107171 / LMG 19424 / R1)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 91% identity to cti:RALTA_A0297)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YB59 at UniProt or InterPro

Protein Sequence (311 amino acids)

>RR42_RS01920 protoheme IX farnesyltransferase (Cupriavidus basilensis FW507-4G11)
MKDKNSPVVTATHTHPLGRVRHLVRQYAALTKPRVTQLAVFCAIIGMFLATPGMVPWPVL
IGGAAGIWLLAGAAFAINCLVEQKVDALMRRTAWRPSATGEITTIQTLVFSAVLGGAGMW
LLHVYTNDLTMWLTVATFVGYAVVYTILLKPATPQNIVIGGLSGAMPPALGWAAVAGDLP
AEAWFLVLIIFTWTPPHFWALALYRRADYAKSGLPMLPVTHGERFTLLHILLYTLIMIAA
TLLPFVYGMCGYIYLAAALILGGGFLAYSWKMYRNYSDALAQRTFRFSILYLSLLFAALL
VDHYFKFLPQA