Protein Info for RR42_RS01845 in Cupriavidus basilensis FW507-4G11

Annotation: glycerol-3-phosphate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01210: NAD_Gly3P_dh_N
  • amino acids 2 to 164 (163 residues), 126.7 bits, E=1.3e-40
• PF07479: NAD_Gly3P_dh_C
  • amino acids 187 to 327 (141 residues), 182.5 bits, E=7.3e-58
• PF20618: GPD_NAD_C_bact
  • amino acids 247 to 313 (67 residues), 79.9 bits, E=2.4e-26

Best Hits

Swiss-Prot: 83% identical to GPDA_CUPNJ: Glycerol-3-phosphate dehydrogenase [NAD(P)+] (gpsA) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K00057, glycerol-3-phosphate dehydrogenase (NAD(P)+) [EC: 1.1.1.94] (inferred from 83% identity to reu:Reut_A0308)

Predicted SEED Role

"Glycerol-3-phosphate dehydrogenase [NAD(P)+] (EC 1.1.1.94)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.94)

MetaCyc Pathways

• phosphatidylglycerol biosynthesis I (6/6 steps found)
• phosphatidylglycerol biosynthesis II (6/6 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (10/12 steps found)
• CDP-diacylglycerol biosynthesis I (4/4 steps found)
• CDP-diacylglycerol biosynthesis II (4/4 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (9/13 steps found)
• CDP-diacylglycerol biosynthesis III (3/5 steps found)
• phosphatidate biosynthesis (yeast) (3/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• 1,3-propanediol biosynthesis (engineered) (4/9 steps found)
• superpathway of phospholipid biosynthesis II (plants) (10/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.94

Sequence Analysis Tools

See A0A0C4Y4E7 at UniProt or InterPro

Protein Sequence (338 amino acids)

>RR42_RS01845 glycerol-3-phosphate dehydrogenase (Cupriavidus basilensis FW507-4G11)
MKITVFGAGAWGTALASHAAAAHDVVLWGRDAAQLAAIGADRVNATYLPGVPLSGRLVVE
PDFERAAAHADVEPDGLVIVATPVSGLREMTRRLAASQAGGLRMLWLCKGFEAGTNALPH
QMVREELTAAGRLADTSYGVLTGPSFAREVALGLPCALTVAGTSPALSELAQQAFHHHAM
RIYGSDDLVGAEVGGAVKNVLAIATGASDGLGLGLNARAALVTRGLAEMTRLGMALGGRV
ETFMGLAGMGDLILTATGDLSRNRKVGQQLAQGKTLAQILAELGHVAEGVRCAQAVAALA
AAKGVDMPITRAVCAVLFEGLPAADAVARLLQRDARDE