Protein Info for RR42_RS01305 in Cupriavidus basilensis FW507-4G11

Annotation: thiazole synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 PF05690: ThiG" amino acids 19 to 266 (248 residues), 328.5 bits, see alignment E=1.3e-102

Best Hits

Swiss-Prot: 88% identical to THIG_CUPNJ: Thiazole synthase (thiG) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K03149, thiamine biosynthesis ThiG (inferred from 88% identity to reu:Reut_A0208)

Predicted SEED Role

"Thiazole biosynthesis protein ThiG" in subsystem Thiamin biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4XYV7 at UniProt or InterPro

Protein Sequence (282 amino acids)

>RR42_RS01305 thiazole synthase (Cupriavidus basilensis FW507-4G11)
MTFNSAEPRRDLFADPFVLYGESFASRLLLGTARYPSPATLQAAVEVARPAMLTVALRRQ
GSVGDGEGGQAFWQMLRSLNVPVLPNTAGCMAPQEAITTAMMAREVFETDWIKLELVGDD
YTLQPDTLNLPAVAETLIKEGFKVLPYCTEDLVLCRRLLDVGCQALMPWAAPIGTGKGAV
NPHAMRLLRERLPDTPLIVDAGLGLPSHAAQVLEWGYDGVLLNTAVAQAAYPVNMARAFA
LAVDAGRTAYLAGPMPERDIAQASTPVVGMPFWHAEGAEDRA