Protein Info for RR42_RS01265 in Cupriavidus basilensis FW507-4G11

Annotation: S-adenosylmethionine synthetase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 387 PF00438: S-AdoMet_synt_N" amino acids 5 to 102 (98 residues), 142.1 bits, see alignment E=1.1e-45 TIGR01034: methionine adenosyltransferase" amino acids 6 to 384 (379 residues), 602.6 bits, see alignment E=1.4e-185 PF02772: S-AdoMet_synt_M" amino acids 117 to 233 (117 residues), 169.3 bits, see alignment E=5.1e-54 PF02773: S-AdoMet_synt_C" amino acids 235 to 373 (139 residues), 227.6 bits, see alignment E=7e-72

Best Hits

Swiss-Prot: 98% identical to METK_CUPNJ: S-adenosylmethionine synthase (metK) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K00789, S-adenosylmethionine synthetase [EC: 2.5.1.6] (inferred from 98% identity to rme:Rmet_0156)

MetaCyc: 69% identical to methionine adenosyltransferase (Escherichia coli K-12 substr. MG1655)
Methionine adenosyltransferase. [EC: 2.5.1.6]

Predicted SEED Role

"S-adenosylmethionine synthetase (EC 2.5.1.6)" in subsystem Methionine Biosynthesis or Methionine Degradation or Quorum Sensing: Autoinducer-2 Synthesis (EC 2.5.1.6)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.6

Use Curated BLAST to search for 2.5.1.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y6G8 at UniProt or InterPro

Protein Sequence (387 amino acids)

>RR42_RS01265 S-adenosylmethionine synthetase (Cupriavidus basilensis FW507-4G11)
MANDFLFTSESVSEGHPDKVADQISDAVLDAILAQDKYARVAAETLCNTGLVVLAGEITT
TANVDYIQVARDTIKRIGYDNTEYGIDYKGCAVLVAYDKQSPDIAQGVDRASDDYLNQGA
GDQGLMFGYACDETPELMPFPIYYSHRLVERQSQLRRDGRLPWLRPDAKSQVTVRYVDGR
PHSVDTVVLSTQHSPDITQAQIREAVIEEIIKPVLPAEMLKDTKYLVNPTGRFVIGGPQG
DCGLTGRKIIVDTYGGASPHGGGAFSGKDPSKVDRSAAYAARYVAKNVVAAGLARQCQVQ
VSYAIGVARPINVTVYTEGTGKISDEAIAALVQEHFDLRPKGIVQMLDLLRPIYEKTAAY
GHFGREEPEFSWEATDKVALLRAAAGL