Protein Info for RR42_RS01175 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 57 to 75 (19 residues), see Phobius details amino acids 87 to 107 (21 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 144 to 160 (17 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 198 to 217 (20 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 257 to 281 (25 residues), see Phobius details amino acids 287 to 305 (19 residues), see Phobius details PF00892: EamA" amino acids 36 to 158 (123 residues), 55.3 bits, see alignment E=4.2e-19 amino acids 171 to 298 (128 residues), 64.2 bits, see alignment E=7.3e-22

Best Hits

KEGG orthology group: None (inferred from 74% identity to cti:RALTA_A0159)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAV8 at UniProt or InterPro

Protein Sequence (314 amino acids)

>RR42_RS01175 membrane protein (Cupriavidus basilensis FW507-4G11)
MNIDRSGAAVASPAATPVPQATEPARRGGAWRMVAAMGLSGTIGWFVVTSGQSPLDVVFF
RCIFGGAALLGTLALRRGWQPMRARDWGWLALGGVTLILNWLALFSAYSYSGISVATVVY
HTQPFFLLLLAALFQREAIAPGRLAWLVLAFGGVMLITGLEHGGATGGMLAGVGLAMLAA
LLYAITTMATRRLKGVPAGQIAGLQMAMGVVMLFPLAHPAVETFGGRTWGALLALGLVHT
GVMYTLLYGAFQRLNVLSIATLSFVYPLVAIVIDVLVFGVVLTPPQLAGMALILLAVIGN
QLGWNPLRQARAGG