Protein Info for RR42_RS01165 in Cupriavidus basilensis FW507-4G11

Annotation: methionine biosynthesis protein MetW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF07021: MetW" amino acids 13 to 200 (188 residues), 287.7 bits, see alignment E=1.2e-89 TIGR02081: methionine biosynthesis protein MetW" amino acids 13 to 200 (188 residues), 285.8 bits, see alignment E=7.1e-90 PF13489: Methyltransf_23" amino acids 18 to 112 (95 residues), 40.4 bits, see alignment E=7.5e-14 PF13847: Methyltransf_31" amino acids 24 to 123 (100 residues), 45.6 bits, see alignment E=2e-15 PF13649: Methyltransf_25" amino acids 29 to 113 (85 residues), 40.4 bits, see alignment E=1.2e-13 PF08241: Methyltransf_11" amino acids 30 to 114 (85 residues), 45.3 bits, see alignment E=3.4e-15 PF08242: Methyltransf_12" amino acids 30 to 112 (83 residues), 31.8 bits, see alignment E=5.9e-11

Best Hits

KEGG orthology group: None (inferred from 95% identity to cti:RALTA_A0155)

Predicted SEED Role

"Methionine biosynthesis protein MetW"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y6F6 at UniProt or InterPro

Protein Sequence (203 amino acids)

>RR42_RS01165 methionine biosynthesis protein MetW (Cupriavidus basilensis FW507-4G11)
MNAAANPNILALRPDFRAIARWIEPNSTVLDLGCGDGSLLRVLQDELDVQAYGIEIQDEG
VLACVQKGVHVIQQNLEGGLALFEDKSFDTVILSQTLQTIHNTAQVLRETLRVGRECIVS
FPNFGYWPHRLSVFRGRMPVSEALPYQWYNTPNVRVLTISDFESLASKVGLRILDRVVMH
EGVTVNWGSNWRGSLAVYRVCAA