Protein Info for RR42_RS01145 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details transmembrane" amino acids 315 to 335 (21 residues), see Phobius details amino acids 342 to 362 (21 residues), see Phobius details amino acids 368 to 390 (23 residues), see Phobius details amino acids 398 to 415 (18 residues), see Phobius details amino acids 421 to 439 (19 residues), see Phobius details PF06123: CreD" amino acids 5 to 446 (442 residues), 481.4 bits, see alignment E=1.2e-148

Best Hits

KEGG orthology group: K06143, inner membrane protein (inferred from 57% identity to rme:Rmet_1650)

Predicted SEED Role

"Inner membrane protein CreD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y460 at UniProt or InterPro

Protein Sequence (477 amino acids)

>RR42_RS01145 membrane protein (Cupriavidus basilensis FW507-4G11)
MNRILFFKSAITAFLILLILIPLHLVGNAVQDRKHYREEAVRSVWQSYAGPQTLTGPVLV
LPYKEILRVTDSSDPKRPNATVLQAQAGQMLVFPTTLRVKGEITPSERYRGIHKVLVYEM
QSRWQGTIALPDPAELPRSAGHFGFEVGQPYITIGISDTRGLMAAPAFELDGKALKLEQG
ALLKSLSQGLHAEIDLPPAKAVKPGLDGRSAQARRVVPFSLALPLLGAQSLAFTPVGDQN
DISLDSAWPHPSFDGDFLPRTRSVSAQGFRSNWSVTSYNTKARGQLAGSGDGTLETVSVT
LIDPVNIYLQAERAVKYGAMFVLLTFAGFFMFELVKRLRIHAIQYLLVGLALAVFFLLLL
SLSEHISFALAYLAASGACIGLLGFYLSFVLQSWRRGLAFATLLTVLYGALYGLLLSEDN
ALMLGSLLMFVILAAIMVMTRRIDWYAAGAAWQPLRDKPAAPSGEDDAAAAAAPASA