Protein Info for RR42_RS01085 in Cupriavidus basilensis FW507-4G11

Annotation: chemotaxis protein CheY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 207 PF00072: Response_reg" amino acids 24 to 142 (119 residues), 64.6 bits, see alignment E=9.2e-22 PF02954: HTH_8" amino acids 163 to 202 (40 residues), 42 bits, see alignment 6e-15

Best Hits

KEGG orthology group: K15012, two-component system, response regulator RegA (inferred from 84% identity to reu:Reut_A0172)

Predicted SEED Role

"Dna binding response regulator PrrA (RegA)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4Y4A4 at UniProt or InterPro

Protein Sequence (207 amino acids)

>RR42_RS01085 chemotaxis protein CheY (Cupriavidus basilensis FW507-4G11)
MTDALHDPAADGAQPGASDAAPFLVIDDDAVFAGALARALTRRGYAVQIAHNRQQALALA
AQTPFDYITLDLHLSAPPEAGSTAPAESGLQLVAPLRAALPDARILVLTGYASIATAVAA
VKHGADEYLAKPANVDSILTALMAGVSEDAAEAAMEEPVPLSVARLEWEHIQRVLSEHEG
NISATARALNMHRRTLQRKLGKRPVSR