Protein Info for RR42_RS00930 in Cupriavidus basilensis FW507-4G11

Annotation: 8-amino-7-oxononanoate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 76% identical to BIOF_CUPNJ: 8-amino-7-oxononanoate synthase (bioF) from Cupriavidus necator (strain JMP 134 / LMG 1197)

KEGG orthology group: K00652, 8-amino-7-oxononanoate synthase [EC: 2.3.1.47] (inferred from 76% identity to reu:Reut_A0148)

Predicted SEED Role

"8-amino-7-oxononanoate synthase (EC 2.3.1.47)" in subsystem Biotin biosynthesis (EC 2.3.1.47)

MetaCyc Pathways

biotin biosynthesis I (13/15 steps found)
8-amino-7-oxononanoate biosynthesis I (9/11 steps found)
biotin biosynthesis II (5/6 steps found)
8-amino-7-oxononanoate biosynthesis III (2/2 steps found)
8-amino-7-oxononanoate biosynthesis IV (4/5 steps found)
8-amino-7-oxononanoate biosynthesis II (1/2 steps found)

KEGG Metabolic Maps

Biotin metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.47

Use Curated BLAST to search for 2.3.1.47

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAR8 at UniProt or InterPro

Protein Sequence (405 amino acids)

>RR42_RS00930 8-amino-7-oxononanoate synthase (Cupriavidus basilensis FW507-4G11)
MLLEHLTLAAAERDEKALTRRRRTAYSACAPQQAVSDACGGEMHSLLTFCSNDYLGLANH
PALIAAMAEGARQFGAGSGASHLVSGHSLAHHRLEGELAAWFAPNIPHAAALYFSTGYMA
NMAVLTALGSADATLFCEALNHASLIDGARLARAEVRRYAHRNMAELEGLLVASTSPLKL
IVTDSVFSMDGDFAPLAELLALAERHDAWIILDDAHGFGVLGEQGHGVLEHLALTSPRFI
YIGTLGKAAGVAGAFVAAHETIIDHLVNTARQYIYTTASPPAVAHALSASLALIAGDEGR
QRRAQLDKLIHTLRSGLAGLTRAAGWRLGESSTAIQPVIVGDNVAALALSAALEADGIRV
GAIRPPTVPVGTARLRITLSASHTVADVERLLASLASVVPRKEAS