Protein Info for RR42_RS00860 in Cupriavidus basilensis FW507-4G11

Annotation: MerR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 PF13411: MerR_1" amino acids 10 to 78 (69 residues), 59.4 bits, see alignment E=4.4e-20 PF00376: MerR" amino acids 11 to 45 (35 residues), 41.6 bits, see alignment E=1.3e-14 PF09278: MerR-DNA-bind" amino acids 55 to 120 (66 residues), 49.5 bits, see alignment E=8.3e-17

Best Hits

KEGG orthology group: None (inferred from 84% identity to cti:RALTA_A0108)

Predicted SEED Role

"Predicted transcriptional regulator LiuR of leucine degradation pathway, MerR family" in subsystem HMG CoA Synthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YAQ4 at UniProt or InterPro

Protein Sequence (144 amino acids)

>RR42_RS00860 MerR family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MPDSPVTPTYTITDLAREFDVTPRAIRFYEDQGLLSPEREGPTGRKRVYNGRERTRLKLT
VRGKRLGLTLNEIREILDLYESPRDTAPQLERFLHSLAHHRGALERQLEDLQAQLADIDQ
HERQCRALLATHGCDVPPDVVKSA