Protein Info for RR42_RS00390 in Cupriavidus basilensis FW507-4G11

Annotation: amidohydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 TIGR01891: amidohydrolase" amino acids 50 to 408 (359 residues), 366.1 bits, see alignment E=1.1e-113 PF01546: Peptidase_M20" amino acids 107 to 417 (311 residues), 159.9 bits, see alignment E=8.3e-51 PF07687: M20_dimer" amino acids 222 to 317 (96 residues), 42.5 bits, see alignment E=5.6e-15

Best Hits

Swiss-Prot: 44% identical to HIPO_CAMJE: Hippurate hydrolase (hipO) from Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168)

KEGG orthology group: K01451, hippurate hydrolase [EC: 3.5.1.32] (inferred from 85% identity to cti:RALTA_A0032)

MetaCyc: 45% identical to beta-tabtoxin peptidase (Pseudomonas syringae)
3.4.11.-

Predicted SEED Role

"Catalyzes the cleavage of p-aminobenzoyl-glutamate to p-aminobenzoate and glutamate, subunit A" in subsystem p-Aminobenzoyl-Glutamate Utilization

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.32

Use Curated BLAST to search for 3.5.1.32

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4XYG8 at UniProt or InterPro

Protein Sequence (422 amino acids)

>RR42_RS00390 amidohydrolase (Cupriavidus basilensis FW507-4G11)
MSEHAPELIESLLADSHATRPAASFASTTSRASRFCELADTVDSRAELEAIRHSIHQHPE
LAFDEVRTAELVATELEGWGYAVTRGVGGTGVVGTLCQGDGPRSIGVRADMDALPIHERT
GLAYASIHAGKMHACGHDGHTTVLLGAARQLARTRNFNGTVNLIFQPAEEIGAGGGAERM
LADGLFERFPCDAIFGLHNHPGVEAGTFMFRAGPFMAACDTVAITIRGKGGHAARPHQSI
DPILVAGSLVMALQSIVSRNIDPNETAVVTIGTLHAGHVANVIPESAKLELSVRSFSPDV
RRTLEDRIRRLVTSHVEGYGATVEIDYIRGYPVLINSERETEFARQVAEELVGPDKVVAN
FPLIAGSEDFAYFLQQRPGCFVRMGNGAGQPLLHNAGYDFNDENLTVGAAYWARLVERYL
EA