Protein Info for RALBFv3_RS23400 in Ralstonia solanacearum IBSBF1503

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 335 PF01965: DJ-1_PfpI" amino acids 24 to 196 (173 residues), 68.7 bits, see alignment E=8.3e-23 PF12833: HTH_18" amino acids 254 to 331 (78 residues), 77.8 bits, see alignment E=9.5e-26 PF00165: HTH_AraC" amino acids 296 to 330 (35 residues), 29 bits, see alignment 1.4e-10

Best Hits

KEGG orthology group: None (inferred from 44% identity to mex:Mext_1153)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (335 amino acids)

>RALBFv3_RS23400 AraC family transcriptional regulator (Ralstonia solanacearum IBSBF1503)
MPRTSSGTKPASGPRPSGPRVRVVALLAYPAVQMLDVAGPADVFAMANAFNGEPAYRVVP
VSSQGGLVRASNGIALDTEAAVSLAPAAIDTLIVAGGEREGLLVTGADAPLAQWARAACA
SARRFGSVCTGAFVLAHWGLLDAHRATTHWASAHLLAQYFARVAVEPEALYVQDGKAWTS
GGVTAGIDMCLSMVEQDLGRWVAARVAKQLILTVRRMGNQSQYSLALEAQSGQYAELVDW
LRGRLHERIGVERMAEAAGEAPRSFHRRFLRETGMTPRAFLERLRLQAARAQLEAGESVK
RTARDTGFSSEGHLAKAFRRRFDLTPSQYQAHCGG