Protein Info for RALBFv3_RS22875 in Ralstonia solanacearum IBSBF1503

Annotation: MoxR family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 PF07726: AAA_3" amino acids 58 to 188 (131 residues), 204.7 bits, see alignment E=1.1e-64 PF07728: AAA_5" amino acids 59 to 186 (128 residues), 51.8 bits, see alignment E=2.2e-17 PF00004: AAA" amino acids 64 to 174 (111 residues), 30.6 bits, see alignment E=1e-10 PF17863: AAA_lid_2" amino acids 248 to 304 (57 residues), 69 bits, see alignment E=6.1e-23

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 95% identity to rso:RS03013)

Predicted SEED Role

"FIG022979: MoxR-like ATPases"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (323 amino acids)

>RALBFv3_RS22875 MoxR family ATPase (Ralstonia solanacearum IBSBF1503)
MTSPHSSLSSLRPTPAAPAQPLSLPAALSQAQRALDRIVLGKPLQIRLALACLLARGHLL
LEDLPGVGKTTLAHALARTLGLQYQRVQFTSDLLPADLIGVSIYLKEKGAFEFHPGPLFA
QVVLADEINRATPKAQSALLEAMAEGQVTHDGATYPLPEPFFVIATQNPLNQIGTHPLPE
SQLDRFTMRLSLGYPDQRSERALYLGGGAAQDIEPALTAAQVVALQAATDAVHVAPALVD
YVLALVNATRTDAQVQMGLSPRAGLALLAAARAWALIDGRDAVLPEDVQAVFNAVAAHRL
LPTGGALSATALAQRLLDTVAIP