Protein Info for RALBFv3_RS21015 in Ralstonia solanacearum IBSBF1503

Annotation: cbb3-type cytochrome c oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 529 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 76 to 98 (23 residues), see Phobius details amino acids 123 to 145 (23 residues), see Phobius details amino acids 157 to 180 (24 residues), see Phobius details amino acids 192 to 213 (22 residues), see Phobius details amino acids 222 to 243 (22 residues), see Phobius details amino acids 258 to 280 (23 residues), see Phobius details amino acids 291 to 308 (18 residues), see Phobius details amino acids 320 to 341 (22 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details amino acids 432 to 456 (25 residues), see Phobius details amino acids 488 to 510 (23 residues), see Phobius details PF00115: COX1" amino acids 76 to 489 (414 residues), 279 bits, see alignment E=3.4e-87

Best Hits

KEGG orthology group: K00404, cb-type cytochrome c oxidase subunit I [EC: 1.9.3.1] (inferred from 80% identity to rme:Rmet_4322)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoN (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (529 amino acids)

>RALBFv3_RS21015 cbb3-type cytochrome c oxidase subunit I (Ralstonia solanacearum IBSBF1503)
MSTVSILLSAFVLSVAALAVFIWSMQRGLFDTSPNAAAVIFDTEAHAPEDPSAAADPAQP
QHDSSRDMADESSAPVVFLFLCCAMVWLLVASLAGLTASVKLHEPDLLATVPWLSFGRIR
TIHLNAVAYGWAPMAGLAIAMFLLPRLLKAPLVGARYAIVGAVLWNAGIIAGLGAISVGI
SQGLEWLEIPWQVDILLVLGGALVAMPLVLTLVNRRVEHLYVSVWYMGCALFWFPVLFLV
ANIPGLHFGVEQATMNWWFGHNVLGLFYTPLALASVYYFLPKIIGRPVQSYGLSLLGFWA
LAFFYGQVGGHHLVGGPVPGWLITLSIVQSMMMLVPVIAFSINQHQTLRGHFRRLIDSPT
LRFVTLGGMMYTLSSIQGSFEALRSVNVVTHFTHFTVAHAHLGLYGFVSLVFFGSIYFIV
PRVVGREWPYRWMIYGHFWLATIGIGIYFVALTIGGTLQGLAMLDAGRPFMDSVAATIPY
LKARSVGGALMVTSHLLFIANFVCVVLGLGPTRDKPAMFHQDRTPIAGA