Protein Info for RALBFv3_RS20465 in Ralstonia solanacearum IBSBF1503

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 37 to 62 (26 residues), see Phobius details amino acids 84 to 106 (23 residues), see Phobius details amino acids 114 to 128 (15 residues), see Phobius details amino acids 184 to 205 (22 residues), see Phobius details amino acids 213 to 234 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 55 to 240 (186 residues), 55.4 bits, see alignment E=3.5e-19

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 90% identity to rsl:RPSI07_mp0515)

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (262 amino acids)

>RALBFv3_RS20465 amino acid ABC transporter permease (Ralstonia solanacearum IBSBF1503)
MADDLLPRAIALVRHTGLDYGFLAEAYERATLLHAAGLSLLVMLGTVVLSLAAGVGLTML
LISPRRWIARLAQGFVALTRNTPTLVQLCCAFLVVNTLITQGLAHWGLANPLTPLFWAVA
ILSLHKAAFHAEALRAGIDAVPPAMLEAAASLGFGVQERLWRVQLPLALRAALPSLMNNT
VELVKASSLASAIAVGELTYSTLMIWTQRGNALECMVLLLLFYGIVTYAVHAGGVRLEHR
LRMPGYGTAATGSGSGSALGHA