Protein Info for RALBFv3_RS19905 in Ralstonia solanacearum IBSBF1503

Annotation: anion transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 409 transmembrane" amino acids 51 to 68 (18 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 119 to 147 (29 residues), see Phobius details amino acids 158 to 178 (21 residues), see Phobius details amino acids 198 to 220 (23 residues), see Phobius details amino acids 240 to 255 (16 residues), see Phobius details amino acids 261 to 279 (19 residues), see Phobius details amino acids 284 to 301 (18 residues), see Phobius details amino acids 321 to 342 (22 residues), see Phobius details amino acids 349 to 373 (25 residues), see Phobius details amino acids 383 to 406 (24 residues), see Phobius details PF03600: CitMHS" amino acids 74 to 342 (269 residues), 111.2 bits, see alignment E=3.1e-36

Best Hits

KEGG orthology group: None (inferred from 91% identity to rso:RS01905)

Predicted SEED Role

"Arsenical pump membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (409 amino acids)

>RALBFv3_RS19905 anion transporter (Ralstonia solanacearum IBSBF1503)
MRVDVLFSHSCCMPDDPSRARADAIRAPAADSSIAPASHHPPFWQSLKQDTFFWLLLIVC
AGLTALAPQRIGQYPRLVDWHTIAALAGLLILTKAVESSGMLQLLGQRLVDAVQSERVLA
LSLVGASAALSTLLTNDVALFVIVPLTVGLRHVARLPVTRLIVFEALAVNAGSALTPIGN
PQNLFLWHQSGLSFGGFVWQMAPMVAMLMLLLLVATWFAFPAQAIHVHSDVGAPELHRRL
LLPALALYVPFLLLTDRGYPVAALAGLVVLYLIGARYVLARVDWGLLLVFVLMFIDLRLV
AQLEPVRHALAMLALTEPTHLYWTGVGLSQVISNVPAAILLAEYSRDWPVMAFAVSVGGF
GFMVGSLANLIALRMARDKRAWLVFHAYSIPFLVVAAGVVSLWLAFSAR