Protein Info for RALBFv3_RS19530 in Ralstonia solanacearum IBSBF1503

Annotation: HrpE/YscL family type III secretion apparatus protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 TIGR02499: type III secretion apparatus protein, HrpE/YscL family" amino acids 36 to 206 (171 residues), 129.7 bits, see alignment E=5.8e-42 PF02108: FliH" amino acids 90 to 212 (123 residues), 38.7 bits, see alignment E=4.7e-14

Best Hits

KEGG orthology group: K03223, type III secretion protein SctL (inferred from 84% identity to rsl:RPSI07_mp0816)

Predicted SEED Role

"Type III secretion inner membrane protein SctL" in subsystem Type III secretion systems, extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>RALBFv3_RS19530 HrpE/YscL family type III secretion apparatus protein (Ralstonia solanacearum IBSBF1503)
MVIWLRREAGLGVSSDVIRAADRHRVVELDAAVQAVYEERDAVLGAARAQAEAIVAQARA
VADGLLKAANERAANSEQRGYADGQRKALAEFHAAMIARTYSEAESTQRVETRLRTAVMQ
AVERVILESDRQALFARVASTLGSVVQSQARLTLRVCPPELDAARAAFARAVEGGLLNAT
VEVLADDSTRPGDCRCEWDHGVADASLDVQLAALRQALAPQAPAHDEAARQAQPAPDDDD
ADDAQDEYEYDDEDEDVEEDLDHEDRDDEEEEDEDVYEEDDEEEEDDEDDEDEEDDE