Protein Info for RALBFv3_RS19365 in Ralstonia solanacearum IBSBF1503

Annotation: cytochrome P450

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 PF00067: p450" amino acids 54 to 442 (389 residues), 148.4 bits, see alignment E=1.5e-47

Best Hits

Swiss-Prot: 34% identical to CPXU_SINFN: Cytochrome P450 BJ-4 homolog (cyp117A2) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 87% identity to rsl:RPSI07_mp0406)

Predicted SEED Role

"cytochrome P450 family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (481 amino acids)

>RALBFv3_RS19365 cytochrome P450 (Ralstonia solanacearum IBSBF1503)
MSDQQETATVAQSDTAQRQSRATPPEVARAGEPARVARPVADNLTMKDGFPIMPGKAPLL
GHVHKISQDALGELRRAEAACGPMFWTYFGTKLPVLQIMDEAGLAILQNKYTDNSFLREQ
MPVITGEAMNAFDGPRHRNARHASSAAFSPTGLTRAQVGQFVVDTIEQRLKRWTRESKLA
IFPETKEIALEVVFRILGIETHELAQWRHQYEEFFLGMIPLKIDLPGFPAWRCRKARRWL
EARVARIVATARANGDHDSLVGAMIFGRDDNGNGMSEVELVHNILGLGFAGSETTASVMA
WSALMLSQHPEIWRQLCQQVAGLHSMPLTHEELVSQVPLAEAIFRETMRLYPPAPFEMRK
VHTEFDMMGHRVPAGAMVGVSLLHVSRNPERYPDPDNWRPERWLGIDRALTPVETCQFGG
GPHACLGRHVAALEITLFIAMLARELGPKGITPRLAGKLPPPAYLPFLRPSNKAFLDLTG
R