Protein Info for RALBFv3_RS19035 in Ralstonia solanacearum IBSBF1503

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 606 transmembrane" amino acids 37 to 57 (21 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 144 to 166 (23 residues), see Phobius details amino acids 172 to 189 (18 residues), see Phobius details amino acids 259 to 282 (24 residues), see Phobius details amino acids 288 to 313 (26 residues), see Phobius details PF00664: ABC_membrane" amino acids 65 to 241 (177 residues), 34.5 bits, see alignment E=1.8e-12 PF00005: ABC_tran" amino acids 365 to 513 (149 residues), 102.8 bits, see alignment E=2.6e-33

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 58% identity to pde:Pden_3018)

Predicted SEED Role

"Inner membrane ABC-transporter YbtQ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (606 amino acids)

>RALBFv3_RS19035 ABC transporter ATP-binding protein (Ralstonia solanacearum IBSBF1503)
MNQDTTDRKRPASLRQAYRRLLDCAGPNARALHRSMIGLGVAAAAQGLALACLFPLLSAV
VERRSMPMALAWLAAMTLAAGFATAVRWRAQGFEYNGRLAQTTHTLRMRLGEQLRRMPLE
TLQDKRAGEMNALLLGSVDENLNYTIAIANLILLATVTPCVVALAALFVDWRVGLILLFV
FPAIVPIYRRRQPGLGRGMRTLAEVHQRLSADIVEFTQGLPVLRAACGDGAKANGMDEAF
QTLLDVQTTTYRQGVKPDLAVASVVELGLQLVVVAAVAWVVMGSLDLSVVAAVMVIVVRF
AEPMATLIGYSAVVEMIETALERIEALLSVAPLPQRGPSRVPSRFDLRFDGVSFRYARAT
DTALADFSATLPTNGMTALVGPSGSGKSTIARLLLRHADPQRGAITIGGVDIRRIPEPAL
SAMISVVFQDVYLFDDTVLANVRMARPEATDDEVMGVARAAHCDEFIERLPQGWQTRLGE
IGGRLSGGERQRISIARALLKNAPIVVLDEPTAALDVASELAVQRAIDVLVRDRTVIVIA
HRLSTVVGADRILVIDGGRLVQQGRHADLIRVEGRYRALWHAQSGAYPDVANEVAVSPHC
VPDGNA