Protein Info for RALBFv3_RS19030 in Ralstonia solanacearum IBSBF1503

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 607 transmembrane" amino acids 30 to 53 (24 residues), see Phobius details amino acids 65 to 85 (21 residues), see Phobius details amino acids 145 to 163 (19 residues), see Phobius details amino acids 169 to 186 (18 residues), see Phobius details amino acids 254 to 274 (21 residues), see Phobius details amino acids 284 to 306 (23 residues), see Phobius details PF00664: ABC_membrane" amino acids 66 to 289 (224 residues), 68.1 bits, see alignment E=1e-22 PF00005: ABC_tran" amino acids 363 to 512 (150 residues), 97.2 bits, see alignment E=1.4e-31

Best Hits

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 66% identity to vei:Veis_2441)

Predicted SEED Role

"ABC transporter ATP-binding protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (607 amino acids)

>RALBFv3_RS19030 ABC transporter ATP-binding protein (Ralstonia solanacearum IBSBF1503)
MPESSIKDTHAAPQQGAWSIMRPVRGQIRFAMGLASLAVLLGLAFLLSLAWIVHRLDALP
HAWPAWPVACAFVCLIGSYLARLGAFGQSHRAAFRLEKILRSELTAHLTRVPLGTLQQVG
AGALSKVVHDDVKALHIFVADSTPLYARAFVGPACTLAVLLWLDWRFTLGAVAVLAIGFG
LLRLSMRNAAQMGRLYNAARERVSAAVIEFVQAMPVVRTFDAGYSTFGRYQHALDAYVDV
LTRWYRQAGFSARCSFAVLNPLPTLLVLLWLGVVLRARGAVEFGTWSAVLLIGTGMAEAM
MPMMTLNHLVAKAKLSVARIQQIMALPLLPVPREGRAPADASVAFEHVGFRYAGADAGGA
LVLRDVSFRVAPGTKTALVGASGAGKTTAARLIPRFWDADAGRVLVGGIDVRDMTADTLM
SQVAFVFQDTFLFADTIANNIRLGSPGSTMGDVIAAAKAAQAHEFILRLPDGYNTRAGER
GAFLSGGQRQRITIARAMLQNRPILVLDEATAFSDPENEAELMRALARLMRGKTVIMIAH
RLSTIRDADQILVFDKGEVIERGRHDALLSIQGVYARLWASHERVQRWVLRGDARASRPQ
TELEHAE