Protein Info for RALBFv3_RS18520 in Ralstonia solanacearum IBSBF1503

Annotation: pilus assembly protein TadC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 118 to 135 (18 residues), see Phobius details amino acids 141 to 159 (19 residues), see Phobius details amino acids 285 to 309 (25 residues), see Phobius details PF00482: T2SSF" amino acids 179 to 304 (126 residues), 52.6 bits, see alignment E=2.3e-18

Best Hits

KEGG orthology group: K12511, tight adherence protein C (inferred from 89% identity to rso:RS02590)

Predicted SEED Role

"Type II/IV secretion system protein TadC, associated with Flp pilus assembly" in subsystem Widespread colonization island

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>RALBFv3_RS18520 pilus assembly protein TadC (Ralstonia solanacearum IBSBF1503)
MDDALLTLSLTAATAGLLVFCGVLVHAVLTRYRSARKLDTALTDVRTAGTQATAPAGTPL
PVPKPRAQAQQLQQQVAKVGRRWIDTGLGQRIVTEEDRRLLEECGYYGEQARTVFGGTRI
LLPPFLCVLGVLYAAAFWKALLWGFAGFALGYLGPKWLLTRRKESRRRRVDDELPVMVDM
LRLLQGVGLSIDQSLQVIANEFYGMLPVLAGEFGRANQQFASGRSREQTLLRIAKMFDSE
DLKGLITLLTQVDRFGGAVQEPLRQFGVRLQENRRSRLKERVGKLTVKMTVVMVLTLLPA
LLIITAGPGFVSVTRTLHHSQPSGGR