Protein Info for RALBFv3_RS17325 in Ralstonia solanacearum IBSBF1503

Annotation: cyclopropane-fatty-acyl-phospholipid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 PF02353: CMAS" amino acids 112 to 370 (259 residues), 286.8 bits, see alignment E=5.1e-89 PF13489: Methyltransf_23" amino acids 163 to 274 (112 residues), 53 bits, see alignment E=1.1e-17 PF13847: Methyltransf_31" amino acids 168 to 271 (104 residues), 28.2 bits, see alignment E=4.6e-10 PF13649: Methyltransf_25" amino acids 173 to 263 (91 residues), 56.4 bits, see alignment E=1.2e-18 PF08241: Methyltransf_11" amino acids 174 to 266 (93 residues), 51 bits, see alignment E=5.7e-17 PF08242: Methyltransf_12" amino acids 174 to 265 (92 residues), 37.6 bits, see alignment E=9.3e-13

Best Hits

KEGG orthology group: K00574, cyclopropane-fatty-acyl-phospholipid synthase [EC: 2.1.1.79] (inferred from 89% identity to rso:RSp1446)

Predicted SEED Role

"Cyclopropane-fatty-acyl-phospholipid synthase (EC 2.1.1.79)" (EC 2.1.1.79)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.79

Use Curated BLAST to search for 2.1.1.79

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>RALBFv3_RS17325 cyclopropane-fatty-acyl-phospholipid synthase (Ralstonia solanacearum IBSBF1503)
MSISDSLAPLRGSRRDDSARRYIEQLLAQADVRIGGTRAWDIQLHDPGVPARVLAFGSLG
LGEAYMDGHWDCASLDQLFERLLRARLDRAVRGMSAVLHHLRARLFNRQTVQRAWQVGHA
HYDLGNAFYAAMLDARMTYTCGFWEGCGTLDEAQEHKLDLVCRKLGLRPGMRVLDIGCGW
GSFMRFAAERYGVQCTGATISAEQADFVRTRCAGLPIEVRLADYRDLDGRFDRIVSLGMF
EHVGRKNHETYLRVAERCLADDGLFLLHTIGRNATGHGTDPWIDRYIFPNGEIPTLADIG
LGCEDRFVVEDLHNFGADYDRTLMAWHANFEAAWPAFAGTLGPRFRRTWRYYLLSCAGAF
RARDLQLWQWVLSKPGRSGVYPRVSSVR