Protein Info for RALBFv3_RS17120 in Ralstonia solanacearum IBSBF1503

Annotation: GntR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 218 transmembrane" amino acids 101 to 120 (20 residues), see Phobius details PF02129: Peptidase_S15" amino acids 17 to 116 (100 residues), 32.7 bits, see alignment E=2e-11 PF00561: Abhydrolase_1" amino acids 38 to 120 (83 residues), 27.4 bits, see alignment E=7.9e-10 PF20408: Abhydrolase_11" amino acids 39 to 193 (155 residues), 32 bits, see alignment E=3.1e-11 PF00326: Peptidase_S9" amino acids 51 to 118 (68 residues), 24.8 bits, see alignment E=4.3e-09

Best Hits

KEGG orthology group: K07018, (no description) (inferred from 64% identity to reh:H16_B1854)

Predicted SEED Role

"Alpha/beta hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (218 amino acids)

>RALBFv3_RS17120 GntR family transcriptional regulator (Ralstonia solanacearum IBSBF1503)
MTGSILLMGPAGRIECLIDRPAGAPLGVAVVAHPHPLQGGSAAHKVPHQIAKALTACGYV
VVRPNFRGVGRSEGVHDLGQGETEDLVHVIRHWRQADSGKLLLAGFSFGAYVMARAVAVL
ADAGVEPAGVVLAGTPWGSVEGQRLYETPAVPAGTLVVHGEQDERVPLSAVFAWARPQGL
PVAVVPGANHFFTGKLGVLARLVTDYAVSRSAGDARQG