Protein Info for RALBFv3_RS15315 in Ralstonia solanacearum IBSBF1503

Annotation: protease modulator HflC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01145: Band_7
  • amino acids 23 to 200 (178 residues), 119.8 bits, E=7e-39
• TIGR01932: HflC protein
  • amino acids 142 to 284 (143 residues), 157.9 bits, E=1.4e-50

Best Hits

Swiss-Prot: 44% identical to HFLC_HAEIN: Protein HflC (hflC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K04087, membrane protease subunit HflC [EC: 3.4.-.-] (inferred from 99% identity to rsl:RPSI07_2154)

Predicted SEED Role

"HflC protein" in subsystem Hfl operon

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Protein Sequence (304 amino acids)

>RALBFv3_RS15315 protease modulator HflC (Ralstonia solanacearum IBSBF1503)
MNRLISALVALVIALAVLSSVVFVVDQRQYAVVFAFGEIKQVIKEPGLHFKLPPPLQNVI
FMDKRLMTIDVAGADRFITAEKKNLLVDWFVKWRIADPRLFYVSFKGDNRLAQDSMTQKI
NSIARDEFARRTVSDVVSTDREAVMQSILKGVQEYGKSVGVDIIDVRLKRVDLLASVTES
VYRRMEAERKRVANELRSTGAAEGEKIRADADRQREVVLADAYREAQKLKGEGDARAADI
YADAFGRDPQFAAFWRSMEAYRASFRDRKDVMVLQPNSDFFKFMRSPNGGGQAAAPAAQA
GRHR