Protein Info for RALBFv3_RS15260 in Ralstonia solanacearum IBSBF1503

Annotation: 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00048: 23S rRNA (adenine(2503)-C(2))-methyltransferase
  • amino acids 4 to 357 (354 residues), 448.6 bits, E=7.2e-139
• PF21016: RlmN_N
  • amino acids 5 to 64 (60 residues), 86.2 bits, E=1e-28
• PF04055: Radical_SAM
  • amino acids 108 to 284 (177 residues), 57.6 bits, E=1.9e-19

Best Hits

Swiss-Prot: 98% identical to RLMN_RALSO: Dual-specificity RNA methyltransferase RlmN (rlmN) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K06941, ribosomal RNA large subunit methyltransferase N [EC: 2.1.1.-] (inferred from 99% identity to rsc:RCFBP_20221)

Predicted SEED Role

"Ribosomal RNA large subunit methyltransferase N (EC 2.1.1.-)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Protein Sequence (383 amino acids)

>RALBFv3_RS15260 23S rRNA (adenine(2503)-C(2))-methyltransferase RlmN (Ralstonia solanacearum IBSBF1503)
MNDMVNLLDFDAQGLLAYCESLGEKSFRAKQLQRWIHQSGAADFGEMTDLAKSLREKLAT
RATIQAPAVISDHLSSDGTRKWLVDVGAGNAVETVYIPEETRGTLCVSSQAGCAVNCRFC
STGKQGFSRNLGTGEIVGQLWMAEFAMRKQLGRGPKDDRVITNVVMMGMGEPLLNYDAVV
PAMRLMLDDNAYGLSRRRVTLSTSGVVPMMDRLSRDLPVALAVSLHASNDALRDVLVPLN
KKYPLAELMAACRRYLEFAPRDFITFEYCMLDGVNDSVEHARELLRVIADVPCKFNLIPF
NPFPESGLKRSNNEQIRRFSQVLLDAGIVTTIRKTRGDDIDAACGQLAGEVKDRTRLAER
GKFGKIVQVPVVGADSTHRMGTA