Protein Info for RALBFv3_RS14815 in Ralstonia solanacearum IBSBF1503

Annotation: cell division protein FtsB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF04977: DivIC" amino acids 11 to 88 (78 residues), 91 bits, see alignment E=1.7e-30

Best Hits

Swiss-Prot: 97% identical to FTSB_RALSO: Cell division protein FtsB (ftsB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K05589, cell division protein FtsB (inferred from 97% identity to rso:RSc1130)

Predicted SEED Role

"Cell division protein DivIC (FtsB), stabilizes FtsL against RasP cleavage"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (111 amino acids)

>RALBFv3_RS14815 cell division protein FtsB (Ralstonia solanacearum IBSBF1503)
MRLITLFLLLLLFAIQYPLWLGKGGWLRVWDMQKQVASQNQRNAEFKQRNVKLEGEVKDL
KEGTGAIEERARYELGMVKDDEGFVQFVAPAPKTSETPLPPPAALQPNHRH