Protein Info for RALBFv3_RS14690 in Ralstonia solanacearum IBSBF1503

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 45 to 68 (24 residues), see Phobius details amino acids 75 to 91 (17 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 130 to 150 (21 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 237 to 257 (21 residues), see Phobius details amino acids 269 to 288 (20 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details amino acids 331 to 352 (22 residues), see Phobius details amino acids 358 to 376 (19 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 96% identity to rsc:RCFBP_20386)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>RALBFv3_RS14690 hypothetical protein (Ralstonia solanacearum IBSBF1503)
MSRALSMQIALFAGVFFPLHVLPPILSDAGFMPGTGDGLRQIVGLAYHLGFMAGAAAALS
FGGPALVLRLEGARRWLALALIAAVAATLIHDPVVQILGRFAYGAGASLLLLLFYRDFAR
SRRYDRLPKVFGCAAILLETGGLVVGLIVTQRGSSAAIMVAIGVTVLALLAGGCLASAAG
PIAGTTFDTGGGTGGRARTGASLSGPWVYMVTAMLAYAGFFLMLLTLGSLRGLDDGALTS
GLAIFSTAFAFSAGNLVRFERWAPLASPIKLVSFGVTLSLAGSLVSWSSIHAQASTGIVV
GAMLVAFGNGITVSRCFQRASIASPDGYSGPLLTMAGVMALTVSLSIVGQLLGGSAPMVQ
FLAFAVALTALLFGGLRADCRSHL