Protein Info for RALBFv3_RS13730 in Ralstonia solanacearum IBSBF1503

Annotation: bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase
  • amino acids 12 to 229 (218 residues), 276.3 bits, E=7.8e-87
• PF06325: PrmA
  • amino acids 37 to 159 (123 residues), 32.3 bits, E=4.2e-11
• PF13489: Methyltransf_23
  • amino acids 42 to 204 (163 residues), 90.4 bits, E=5.8e-29
• PF01209: Ubie_methyltran
  • amino acids 44 to 177 (134 residues), 38.4 bits, E=5.1e-13
• PF05175: MTS
  • amino acids 46 to 122 (77 residues), 26.6 bits, E=2.3e-09
• PF08003: Methyltransf_9
  • amino acids 46 to 155 (110 residues), 24.1 bits, E=9.4e-09
• PF02353: CMAS
  • amino acids 51 to 162 (112 residues), 30.5 bits, E=1.3e-10
• PF07021: MetW
  • amino acids 51 to 139 (89 residues), 25.1 bits, E=6.8e-09
• PF13847: Methyltransf_31
  • amino acids 52 to 156 (105 residues), 57.8 bits, E=6e-19
• PF13649: Methyltransf_25
  • amino acids 55 to 148 (94 residues), 67.5 bits, E=7.9e-22
• PF08242: Methyltransf_12
  • amino acids 56 to 150 (95 residues), 61.3 bits, E=6.6e-20
• PF08241: Methyltransf_11
  • amino acids 56 to 152 (97 residues), 79.1 bits, E=1.8e-25

Best Hits

Swiss-Prot: 98% identical to UBIG_RALSO: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 99% identity to rsl:RPSI07_2486)

MetaCyc: 58% identical to bifunctional 3-demethylubiquinone-8 3-O-methyltransferase and 2-octaprenyl-6-hydroxyphenol methylase (Escherichia coli K-12 substr. MG1655)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; 2-OCTAPRENYL-6-OHPHENOL-METHY-RXN [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (11/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (7/8 steps found)
• superpathway of chorismate metabolism (43/59 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (5/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.222 or 2.1.1.64

Protein Sequence (239 amino acids)

>RALBFv3_RS13730 bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG (Ralstonia solanacearum IBSBF1503)
MTTTYANADPGELEKFSELAHRWWDPNSEFKPLHEINPLRLDWIQSMAPLAGKRVVDVGC
GGGILSESMARAGADVKGIDLSRKALRVADLHGLEAGVAVDYEEIAAEALAAREPGSFDV
VTCMEMLEHVPDPASVVRACATLVKPGGHVFFSTIHRNAKAYLLAVIGAEYVLNMLPRGT
HDYAKFIRPSELAGFARTAGLEPAQLRGLEYNPITGRYALTHDTSVNYLMATRRPGTAP