Protein Info for RALBFv3_RS12725 in Ralstonia solanacearum IBSBF1503

Annotation: protein-L-isoaspartate O-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 PF01135: PCMT" amino acids 27 to 222 (196 residues), 105.6 bits, see alignment E=1.3e-33 PF13489: Methyltransf_23" amino acids 85 to 169 (85 residues), 30.2 bits, see alignment E=1.4e-10 PF05175: MTS" amino acids 87 to 163 (77 residues), 33.4 bits, see alignment E=1.4e-11 PF06325: PrmA" amino acids 91 to 146 (56 residues), 22.9 bits, see alignment E=2.2e-08 PF13847: Methyltransf_31" amino acids 94 to 187 (94 residues), 34.5 bits, see alignment E=6.6e-12 PF13649: Methyltransf_25" amino acids 98 to 173 (76 residues), 40.9 bits, see alignment E=1.1e-13 PF08241: Methyltransf_11" amino acids 99 to 172 (74 residues), 36.1 bits, see alignment E=3.4e-12

Best Hits

Swiss-Prot: 38% identical to PIMT_RHOPA: Protein-L-isoaspartate O-methyltransferase (pcm) from Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009)

KEGG orthology group: K00573, protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC: 2.1.1.77] (inferred from 98% identity to rsc:RCFBP_20717)

Predicted SEED Role

"Protein-L-isoaspartate O-methyltransferase (EC 2.1.1.77)" in subsystem Ton and Tol transport systems (EC 2.1.1.77)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.77

Use Curated BLAST to search for 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>RALBFv3_RS12725 protein-L-isoaspartate O-methyltransferase (Ralstonia solanacearum IBSBF1503)
MPGLSTNPHSLRIEGMPMDIEKSRFNMIEQQIRPWDVLDLDVLDLLAVVKREQYVPEAYR
ALAFVDMEIPLPGGRNMLPPRVEARVLQELAVRKHEDVLEVGAGSGYMAALLAHRGRHVT
TVDIAPELVAFARDNLARNGVTNADVAEGNAALGWGNSLYDVICVSGSVPAVPESLLMQL
KVGGRLSIFVGGAPVMEAQLITRVSEAEFQTRNLFETYVTPLAGVPAPSQFRF