Protein Info for RALBFv3_RS12575 in Ralstonia solanacearum IBSBF1503

Annotation: response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF00072: Response_reg" amino acids 32 to 144 (113 residues), 88.8 bits, see alignment E=1.4e-29

Best Hits

KEGG orthology group: K02657, twitching motility two-component system response regulator PilG (inferred from 100% identity to rsc:RCFBP_20747)

Predicted SEED Role

"twitching motility protein PilG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (155 amino acids)

>RALBFv3_RS12575 response regulator (Ralstonia solanacearum IBSBF1503)
MVAQRENMMQSARVEQPNNSQPLASSLAGRKVLVIDDSSTIRRTAQIFLSKVDCQVVLAE
DGFDALAKLGDFKPDIVFCDILMPKLDGYLTCSLIKKSPKFHATPVVMLSSRDGVFDRAR
GKLVGAVDHLAKPFSREALLEAVQAHLPAAAGAAQ