Protein Info for RALBFv3_RS10020 in Ralstonia solanacearum IBSBF1503

Annotation: Lrp/AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 152 PF13412: HTH_24" amino acids 3 to 50 (48 residues), 53.3 bits, see alignment E=5e-18 PF13404: HTH_AsnC-type" amino acids 3 to 44 (42 residues), 52.2 bits, see alignment E=1.3e-17 PF01047: MarR" amino acids 7 to 50 (44 residues), 25.8 bits, see alignment E=2.4e-09 PF12840: HTH_20" amino acids 10 to 50 (41 residues), 29.3 bits, see alignment E=2e-10 PF01037: AsnC_trans_reg" amino acids 69 to 136 (68 residues), 44.7 bits, see alignment E=3.1e-15

Best Hits

Swiss-Prot: 32% identical to REG8_PYRFU: Uncharacterized HTH-type transcriptional regulator PF1734 (PF1734) from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1)

KEGG orthology group: None (inferred from 93% identity to rsl:RPSI07_3253)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (152 amino acids)

>RALBFv3_RS10020 Lrp/AsnC family transcriptional regulator (Ralstonia solanacearum IBSBF1503)
MELDKKDWLILEALQADARQSLAALGKRIGLSQPAMSERVRKLEDAGVIEGYGARVNLRS
VGIGLQAIIHIDTTHAHIRKYTKLFETMPEVLEASRVTGAHCFIVRCAIAGPDDLERVVD
SLAAHGAVTTALVLSTPVCKAVTVQAAQRPGR