Protein Info for RALBFv3_RS09390 in Ralstonia solanacearum IBSBF1503

Annotation: chromosomal replication initiator protein DnaA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 534 PF11638: DnaA_N" amino acids 17 to 79 (63 residues), 61.4 bits, see alignment E=1.4e-20 TIGR00362: chromosomal replication initiator protein DnaA" amino acids 19 to 532 (514 residues), 562.5 bits, see alignment E=3.8e-173 PF00308: Bac_DnaA" amino acids 199 to 416 (218 residues), 289.3 bits, see alignment E=5.7e-90 PF01695: IstB_IS21" amino acids 235 to 336 (102 residues), 25.2 bits, see alignment E=2.7e-09 PF00004: AAA" amino acids 235 to 356 (122 residues), 25.1 bits, see alignment E=5.1e-09 PF08299: Bac_DnaA_C" amino acids 443 to 511 (69 residues), 108.1 bits, see alignment E=4.5e-35

Best Hits

Swiss-Prot: 96% identical to DNAA_RALSO: Chromosomal replication initiator protein DnaA (dnaA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02313, chromosomal replication initiator protein (inferred from 97% identity to rsc:RCFBP_10001)

Predicted SEED Role

"Chromosomal replication initiator protein DnaA" in subsystem DNA-replication

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (534 amino acids)

>RALBFv3_RS09390 chromosomal replication initiator protein DnaA (Ralstonia solanacearum IBSBF1503)
MTTRVAPSKHLTITMQDFWHAASAQLESELTPQQFKTWIKPLTPLSFDEQACMLRIAAPN
RFKLDWVKSQFSGRIQSLACDYWEMQVDVQFVLDPTAGQRQAAMQPALAPMPMQPQAAQP
MQTQPHAAPTRPTAAPYRETAVAAAAHTAADIDVPVMDAAEARAQSYRVPASAPPAAMMS
LSPPPAAPVDDTVHERSRLNPILTFDNLVTGKANQLARAAAVQVANNPGKSYNPLYLYGG
VGLGKTHLIHAIGNFMLMENPRARIRYIHAEQYVSDVVKAYQRKAFDDFKRYYHSLDLLL
IDDIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEITGIDDRLISRFDSGLTVA
IEPPELEMRVAILMKKAQAENVTVPEEVAFFVAKHLRSNVRELEGALRKILAYSNFHGKE
ITIEVTREALKDLLTVQNRQISVENIQKTCADFYNIKVADMYSKKRPANIARPRQIAMYL
AKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQLNHELHVLEQTLKG