Protein Info for RALBFv3_RS08655 in Ralstonia solanacearum IBSBF1503

Annotation: glycine cleavage system protein H

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00527: glycine cleavage system H protein
  • amino acids 3 to 123 (121 residues), 154.1 bits, E=9.9e-50
• PF01597: GCV_H
  • amino acids 8 to 123 (116 residues), 148.9 bits, E=6.6e-48
• PF00364: Biotin_lipoyl
  • amino acids 47 to 78 (32 residues), 22.7 bits, E=7.2e-09

Best Hits

Swiss-Prot: 88% identical to GCSH_RALSO: Glycine cleavage system H protein (gcvH) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 99% identity to rsc:RCFBP_10182)

MetaCyc: 57% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

Protein Sequence (127 amino acids)

>RALBFv3_RS08655 glycine cleavage system protein H (Ralstonia solanacearum IBSBF1503)
MSNTPAELKYTESHEWVRTEADGTLTIGITDLAQEQLGDIVFLELPEAGRKVNKGEAIAV
VESVKAASDIYAPVAGEIIGNNADAAGSPESVNEDAYDAWLFKIKPANVDDVNALLSADQ
YKAAAGA