Protein Info for RALBFv3_RS08610 in Ralstonia solanacearum IBSBF1503

Annotation: acyl-homoserine-lactone synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF00765: Autoind_synth" amino acids 21 to 186 (166 residues), 85.3 bits, see alignment E=4.1e-28 PF13444: Acetyltransf_5" amino acids 23 to 106 (84 residues), 26.1 bits, see alignment E=1.2e-09

Best Hits

Swiss-Prot: 97% identical to SOLI_RALSL: Acyl-homoserine-lactone synthase (solI) from Ralstonia solanacearum

KEGG orthology group: K13061, acyl homoserine lactone synthase [EC: 2.3.1.184] (inferred from 96% identity to rsc:RCFBP_10191)

Predicted SEED Role

"N-acyl-L-homoserine lactone synthetase RhlL" in subsystem Quorum sensing regulation in Pseudomonas or Rhamnolipids in Pseudomonas

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.184

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>RALBFv3_RS08610 acyl-homoserine-lactone synthase (Ralstonia solanacearum IBSBF1503)
MRTFVHGGGRLPEGVDAALAHYRHQVFVGRLGWQLPMADGTFERDQYDRDDTVYVVARDE
GGTICGCARLLPTTRPYLLKEVFASLLMHGMPPPESPEVWELSRFAARSGAPCLRSGRSD
WAVRPMLASVVQCAAQRGARRLIGATFVSMVRLFRRIGVRAHRAGPVRCIGGRPVVACWI
DIDASTCAALGIPGASVAPGPVLQ