Protein Info for RALBFv3_RS08490 in Ralstonia solanacearum IBSBF1503

Annotation: YraN family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 133 TIGR00252: TIGR00252 family protein" amino acids 14 to 130 (117 residues), 99.8 bits, see alignment E=5.2e-33 PF02021: UPF0102" amino acids 20 to 117 (98 residues), 97.4 bits, see alignment E=2.7e-32

Best Hits

Swiss-Prot: 86% identical to Y3265_RALSO: UPF0102 protein RSc3265 (RSc3265) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K07460, putative endonuclease (inferred from 94% identity to rsc:RCFBP_10215)

Predicted SEED Role

"Predicted endonuclease distantly related to archaeal Holliday junction resolvase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (133 amino acids)

>RALBFv3_RS08490 YraN family protein (Ralstonia solanacearum IBSBF1503)
MHAPQPMPSPHDSAATGEAGEDRALRYLQARGLSAVARNYRCKTGEIDLVMRDAAGTLVF
VEVRARVARSTRRFGGAAASVTPAKQRRLVAAAEDFLAHHAGCHDDVPACRFDVIAIDGA
RIEWMRDAFGAEA