Protein Info for RALBFv3_RS08470 in Ralstonia solanacearum IBSBF1503

Annotation: O-acetylserine/cysteine exporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 32 to 51 (20 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 115 to 134 (20 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 172 to 195 (24 residues), see Phobius details amino acids 211 to 232 (22 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details amino acids 270 to 288 (19 residues), see Phobius details PF00892: EamA" amino acids 6 to 131 (126 residues), 49 bits, see alignment E=3.7e-17 amino acids 147 to 286 (140 residues), 62.9 bits, see alignment E=1.8e-21

Best Hits

KEGG orthology group: K03298, drug/metabolite transporter, DME family (inferred from 98% identity to rsc:RCFBP_10219)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>RALBFv3_RS08470 O-acetylserine/cysteine exporter (Ralstonia solanacearum IBSBF1503)
MSPKDLLLALTVVLVWGVNFVVIKVGLHGVPPMLLGALRFLLVAFPAVLFVPRPKIALKW
LLAYGATISLGQFAFLFSAMYVGMPAGLASLVLQSQAFFTLTIAAVVLREPIRWFHLAGM
AVAACGLAMIGMAGTSSAGAATGMTTAGFLLTLCAAFSWSSGNIVTKRIGPVNVVSLVVW
AALIPPVPFFLLSYWMEGPQQIAHSLANLGGSSIGAIVYLAFGATLFGYSLWSRLLARYA
ASQVAPLTLLVPVVGLVSAALLLGERLAPAQWLGGAVVMAGLLLNVFGGRWATRRALA