Protein Info for RALBFv3_RS07750 in Ralstonia solanacearum IBSBF1503

Annotation: DUF4153 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 34 to 53 (20 residues), see Phobius details amino acids 63 to 82 (20 residues), see Phobius details amino acids 96 to 114 (19 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 174 to 192 (19 residues), see Phobius details amino acids 212 to 232 (21 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 273 to 298 (26 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 94% identity to rsc:RCFBP_10321)

Predicted SEED Role

"putative MFS transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (579 amino acids)

>RALBFv3_RS07750 DUF4153 domain-containing protein (Ralstonia solanacearum IBSBF1503)
MPSLRLMLIALAQGAGLYLCGRLAGTSLPDAQRALLAAAHTVLVFGPTAYYLCERPAAPR
RLLSLLALAALLIGALAGYSHWMGGTTAKDLLDPGRGLLVSAVLWGLALPLIQLRADGRA
LTDYPALFQASWRDAILVIDAAIFTGVFWAVLFLGAQLFHVIGLHLFREIIQKAAFAWPA
TTLCFAYAVQLCRRHAVMVESIQRHALSACKWLLPLTLLIAGGFVVALPFTGLKALWATR
YAATLLLWLLAVSVLFINAAYGDGTEPPGYPRWLAAALRAGMLALPVLGGLALVALGLRV
RQHGLTVERVWGMLVAVAGCVYALGYAAAALRRGAWLGGIGRINVAVALGLIVAIALLTG
PLLEQHRLAANSQVARLATGKVAADKFDYDALRFDMGRPGRDALARLVADTALANHAEIG
RRATVALAKQRRWGNDLAVDFDTLLAGTKIYPAGATLPADFIDFARAHQDAFKSLACEAG
GSGACGLIMLDLNGDGQIEILPAIPQYRPELYSRTAAGWKAIGYLEAAEHGCHRETSDAD
ADAAVATAAAPLWRDVMIGKHRWVVVPDLSADCPTAKKP