Protein Info for RALBFv3_RS07270 in Ralstonia solanacearum IBSBF1503

Annotation: 50S ribosomal protein L7/L12

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00855: ribosomal protein bL12
  • amino acids 1 to 124 (124 residues), 162.6 bits, E=2.6e-52
• PF16320: Ribosomal_L12_N
  • amino acids 4 to 52 (49 residues), 66.9 bits, E=1e-22
• PF00542: Ribosomal_L12
  • amino acids 58 to 124 (67 residues), 103 bits, E=9e-34

Best Hits

Swiss-Prot: 98% identical to RL7_RALSO: 50S ribosomal protein L7/L12 (rplL) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K02935, large subunit ribosomal protein L7/L12 (inferred from 98% identity to rso:RSc3035)

MetaCyc: 64% identical to 50S ribosomal subunit protein L12 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L7/L12 (P1/P2)" in subsystem Ribosome LSU bacterial

Protein Sequence (124 amino acids)

>RALBFv3_RS07270 50S ribosomal protein L7/L12 (Ralstonia solanacearum IBSBF1503)
MAITKDDILEAVGAMSVMELNDLVKAFEEKFGVSAAAVAVAGPAGGAAAPAAEEKTEFDV
ILKGAGANKVGVIKAVREITGLGLKEAKDLVDGAPKTVKEAMPKADADAAAKKLIEAGAE
VEVK