Protein Info for RALBFv3_RS07060 in Ralstonia solanacearum IBSBF1503

Annotation: DNA-directed RNA polymerase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 TIGR02027: DNA-directed RNA polymerase, alpha subunit" amino acids 21 to 314 (294 residues), 353.9 bits, see alignment E=3.2e-110 PF01193: RNA_pol_L" amino acids 26 to 224 (199 residues), 84 bits, see alignment E=7.1e-28 PF01000: RNA_pol_A_bac" amino acids 56 to 173 (118 residues), 114.8 bits, see alignment E=4.2e-37 PF03118: RNA_pol_A_CTD" amino acids 248 to 306 (59 residues), 86.2 bits, see alignment E=1.5e-28

Best Hits

Swiss-Prot: 100% identical to RPOA_RALSO: DNA-directed RNA polymerase subunit alpha (rpoA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03040, DNA-directed RNA polymerase subunit alpha [EC: 2.7.7.6] (inferred from 98% identity to reh:H16_A3458)

Predicted SEED Role

"DNA-directed RNA polymerase alpha subunit (EC 2.7.7.6)" in subsystem RNA polymerase bacterial (EC 2.7.7.6)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.6

Use Curated BLAST to search for 2.7.7.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (326 amino acids)

>RALBFv3_RS07060 DNA-directed RNA polymerase subunit alpha (Ralstonia solanacearum IBSBF1503)
MQTALLKPKIIAVEPLGDHHAKVVMEPFERGYGHTLGNALRRVLLSSMVGYAPTEVTIAG
VVHEYSTIDGVQEDVVNLLLNLKGVVFKLHNRDEVTVSLRKDGEGVVTAADIELPHDVEI
INPGHVIASLSAGGKLDMQIKVEQGRGYVPGNVRKFGDESSKVIGRIVLDASFAPVRRVS
YAVESARVEQRTDLDKLVMNIETNGVISPEEAIRQSARILVDQLSVFAALEGTESAAEAA
AARAPQIDPILLRPVDDLELTVRSANCLKAENIYYIGDLIQRTENELLKTPNLGRKSLNE
IKEVLASRGLTLGMKLENWPPAGLEK