Protein Info for RALBFv3_RS06595 in Ralstonia solanacearum IBSBF1503

Annotation: peptide chain release factor N(5)-glutamine methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 295 TIGR00536: methyltransferase, HemK family" amino acids 14 to 284 (271 residues), 223 bits, see alignment E=4.3e-70 PF17827: PrmC_N" amino acids 19 to 81 (63 residues), 52 bits, see alignment E=4e-17 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 31 to 283 (253 residues), 276.6 bits, see alignment E=1.9e-86 PF06325: PrmA" amino acids 109 to 196 (88 residues), 29.5 bits, see alignment E=2.4e-10 PF05175: MTS" amino acids 112 to 207 (96 residues), 51 bits, see alignment E=6.3e-17 PF10294: Methyltransf_16" amino acids 115 to 194 (80 residues), 23.7 bits, see alignment E=1.7e-08 PF03602: Cons_hypoth95" amino acids 118 to 202 (85 residues), 28.4 bits, see alignment E=5.8e-10 PF13847: Methyltransf_31" amino acids 121 to 197 (77 residues), 43.2 bits, see alignment E=1.6e-14 PF13649: Methyltransf_25" amino acids 122 to 196 (75 residues), 36 bits, see alignment E=4.1e-12

Best Hits

Swiss-Prot: 59% identical to PRMC_BORPE: Release factor glutamine methyltransferase (prmC) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 96% identity to rsc:RCFBP_10553)

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (295 amino acids)

>RALBFv3_RS06595 peptide chain release factor N(5)-glutamine methyltransferase (Ralstonia solanacearum IBSBF1503)
MPSTSAIPPAALPRVADALTALTGAGLPALEARMLVSHVTGLSRVQLITQDTYAIDNGIR
TRLAELATRRLAGEPMAYLLGEREFFGRLFQVTPAVLIPRPDTELLVEQALDRIEDRDTP
DVLDLGTGSGIIAVTIALARRDARVWATDASADALAVAAGNAQTLGATNVHVALGDWYGA
LPESDAPPAFDLIVSNPPYIASADAHLDQGDLRFEPAGALTDHGDGLRHLRTIVAGAPAR
LAADGWLLLEHGYDQGPAVRALLAEAGFADAFTTQDLAGHDRCSGGRRPATQDAA