Protein Info for RALBFv3_RS05845 in Ralstonia solanacearum IBSBF1503

Annotation: 4-hydroxy-tetrahydrodipicolinate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase
  • amino acids 1 to 262 (262 residues), 295.7 bits, E=1.8e-92
• PF01113: DapB_N
  • amino acids 1 to 123 (123 residues), 131.9 bits, E=1.4e-42
• PF05173: DapB_C
  • amino acids 126 to 261 (136 residues), 159.7 bits, E=3.9e-51

Best Hits

Swiss-Prot: 95% identical to DAPB_RALSO: 4-hydroxy-tetrahydrodipicolinate reductase (dapB) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 98% identity to rsc:RCFBP_10705)

MetaCyc: 56% identical to 4-hydroxy-tetrahydrodipicolinate reductase (Escherichia coli K-12 substr. MG1655)
RXN-14014 [EC: 1.17.1.8]

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

• aspartate superpathway (23/25 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
• L-lysine biosynthesis I (9/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
• L-lysine biosynthesis II (8/9 steps found)
• L-lysine biosynthesis III (6/7 steps found)
• L-lysine biosynthesis VI (6/7 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Protein Sequence (263 amino acids)

>RALBFv3_RS05845 4-hydroxy-tetrahydrodipicolinate reductase (Ralstonia solanacearum IBSBF1503)
MKIAIAGASGRMGQMLIDTVLRTPGVTLAAALDRAGSDAVGQDAGAKLGKATGVIITDDV
RAGLSQADVLIDFTRPEATLAHLEIARELGVGVVIGTTGFTAEQKASFKGYGTAIGVVWA
PNMSVGVNATFKLIEVAAKILAQGYDVEIIEAHHKHKIDAPSGTALKMGEVVAEAQGTAL
AERAVYAREGDTGPRVNGTIGFATVRGGDIVGDHTVLFIGEGERIEITHRSNSRQSYAEG
AVRAACFLAGKKGLFDMNDVLGL