Protein Info for RALBFv3_RS05510 in Ralstonia solanacearum IBSBF1503

Annotation: LrgB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 243 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 105 to 128 (24 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 216 to 241 (26 residues), see Phobius details PF04172: LrgB" amino acids 26 to 239 (214 residues), 272.4 bits, see alignment E=1.2e-85

Best Hits

Swiss-Prot: 34% identical to YXAC_BACSU: Uncharacterized protein YxaC (yxaC) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 100% identity to rsc:RCFBP_10778)

Predicted SEED Role

"LrgA-associated membrane protein LrgB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (243 amino acids)

>RALBFv3_RS05510 LrgB family protein (Ralstonia solanacearum IBSBF1503)
MNAMTPDLHKLWVYLAASPLLGLTATLIAYLIAFRLYERSRFNPLVNPLLIAVAILATLL
TLTGTPYKTYFDGAQFVHFLLGPATVALSIPLYQQWPKLRRHALPLLAGLVAGALVATVS
AVGIAWLLGASHETLHSIAPKSVTIPIAMGISEKIGGAPSMTAVLVLITGITGASTTTRL
LNLLRIREYSVRGFATGIAAHGIGTARAFQVNPEAGAFAALGMGLNGIVTAVMVPLLAGW
IPR