Protein Info for RALBFv3_RS05045 in Ralstonia solanacearum IBSBF1503

Annotation: site-2 protease family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 29 to 49 (21 residues), see Phobius details amino acids 61 to 79 (19 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 119 to 139 (21 residues), see Phobius details amino acids 154 to 182 (29 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details PF02163: Peptidase_M50" amino acids 40 to 111 (72 residues), 36.4 bits, see alignment E=1.8e-13

Best Hits

KEGG orthology group: None (inferred from 96% identity to rsl:RPSI07_0941)

Predicted SEED Role

"Membrane metalloprotease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>RALBFv3_RS05045 site-2 protease family protein (Ralstonia solanacearum IBSBF1503)
MAKLLILLFSGLKFGKLLTTGGTMLLSVVAYAFVFGWRYAAGFVVLLFIHEMGHYVAARR
RGLAVGAPTFIPFVGAWIDLKDQPMDVETEAHIGLAGPVAGTVGAMLCYGLARWTDSQLL
LALAYAGCLLNLFNLIPLAPFDGGRITAVLSPRIWFLGVPVLVALFVWRASPILVLMAIL
AVPQLMKAWHYDPDAPENRAYYSISAEARLTFTVYYLGLVVFLAMMTYELHDILEVVRPA
G