Protein Info for RALBFv3_RS04995 in Ralstonia solanacearum IBSBF1503

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 520 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details transmembrane" amino acids 328 to 350 (23 residues), see Phobius details amino acids 358 to 378 (21 residues), see Phobius details amino acids 384 to 402 (19 residues), see Phobius details amino acids 438 to 465 (28 residues), see Phobius details amino acids 484 to 505 (22 residues), see Phobius details PF04069: OpuAC" amino acids 35 to 296 (262 residues), 172.7 bits, see alignment E=1.2e-54 PF00528: BPD_transp_1" amino acids 342 to 511 (170 residues), 77.7 bits, see alignment E=9.6e-26

Best Hits

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 97% identity to rsc:RCFBP_10882)

Predicted SEED Role

"L-proline glycine betaine binding ABC transporter protein ProX (TC 3.A.1.12.1) / Osmotic adaptation" in subsystem Choline and Betaine Uptake and Betaine Biosynthesis (TC 3.A.1.12.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (520 amino acids)

>RALBFv3_RS04995 ABC transporter permease (Ralstonia solanacearum IBSBF1503)
MDTRRLIRSPLLRRILVWMALGWLACGTLAWAEPPLRIGSKRFTESYVLGEVLTQTAAPH
GPAEHVPGLGNTAIVFAALKSGNIDLYPDYLGTIAAEILHLPPAQAANPDQAALLADVNR
ALAPLGLGAGVPLGFEDTYALAMREADAERSGLRTLADLATHPALRLGLSHEFLGRADGW
PALAARYRLPQQPIGLDHGVAYDALRAGQTDVIDIYSTDARIRREHLRVLEDSAHVFPRY
DAVALYRLDVPARHPAQWQAISALAGHIHRDDMVAMNAAVELEGQSFARVASQFLAGHGT
SPARADAPVHAFSARLTDGLWRLTRRHLALVAASTGAAVLIGMPLGLLAARRRIQQPVLA
IVGVLQTIPSLALLAMLIPLVGSIGVVPALIALTLYALLPIVRNTIVGLEQVPDGLRDAA
LALGLTPAQRTRVVDLPLALPVILAGIKTAAVISVGTATIAAFIGAGGYGERIATGLALN
DSATLLAGAIPAAVLALLVQGAFEAAERWLRRRRQPPPPR