Protein Info for RALBFv3_RS04770 in Ralstonia solanacearum IBSBF1503

Annotation: hybrid sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 610 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 180 to 198 (19 residues), see Phobius details PF00512: HisKA" amino acids 235 to 298 (64 residues), 46.5 bits, see alignment E=4.6e-16 PF02518: HATPase_c" amino acids 347 to 453 (107 residues), 80.1 bits, see alignment E=2.5e-26 PF00072: Response_reg" amino acids 485 to 593 (109 residues), 57.6 bits, see alignment E=2.1e-19

Best Hits

KEGG orthology group: None (inferred from 99% identity to rsc:RCFBP_10969)

Predicted SEED Role

"FOG: CheY-like receiver"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (610 amino acids)

>RALBFv3_RS04770 hybrid sensor histidine kinase/response regulator (Ralstonia solanacearum IBSBF1503)
MTASLRPLLNKLGLASRAPLELDARAKLLAAVHRGAPMGIAASVVLPVLTLAAFWDSGSR
LALAGWCLIMLCLTASGLRFYFGYRYDITRMTLAAHTRKWWTGMRIMSAVGGVAWGSSAG
LYLVSPSLEFSSLLMIVIIGVAAGAVLSQAPVPSNLLILGTGILAPHFALAEQAFPEHGL
YVRGVLLFFVAFLARHAANIHSTLVREIQLENESRQLARRYQDEKQRALSASEEKSRFLA
AASHDLRQPVHALVLLVEALRARNQSETLAPLVEQLASGAQTIDLLFRSLLDLSKLESRK
TSPTLEPVDLGEVITEVVQQFLPDARAKGLALTQRIPPLPVFGMAEPVLLRRALFNLLQN
ALRYTSHGGVMVALRVRQKHLRIEVWDTGIGIAPEHQKDIFSSYYQVENPERDPSQGLGL
GLAIYKECVRLLRGTFGVRSVPGRGSMFWMALRPVPAEIKAPLAAQPRSEQKRAVLDQPR
FSGVVLVVDDDAQIRKAWHALLEAWGVEVHSAADGPTADQLLTRGLRPQIIFCDLRLPGK
EDGLQLLERWQVSHPEAHAVLLTGDRNSAALARAEEAGYLLLAKPMDPNMLRVLLKRWLR
GRAAEPQVAY