Protein Info for RALBFv3_RS03755 in Ralstonia solanacearum IBSBF1503

Annotation: TIGR00730 family Rossman fold protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR00730: TIGR00730 family protein" amino acids 135 to 308 (174 residues), 145.6 bits, see alignment E=6.5e-47 PF18306: LDcluster4" amino acids 135 to 248 (114 residues), 53.9 bits, see alignment E=1.5e-18 PF03641: Lysine_decarbox" amino acids 177 to 306 (130 residues), 111.9 bits, see alignment E=2.7e-36

Best Hits

KEGG orthology group: K06966, (no description) (inferred from 98% identity to rsc:RCFBP_11161)

Predicted SEED Role

"FIG00975981: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>RALBFv3_RS03755 TIGR00730 family Rossman fold protein (Ralstonia solanacearum IBSBF1503)
MDSNVTGTPDGVSDNGASAEGGVAKQAAGVSAAELTGARPARQATAADMDVNVTVDTADA
GHASADAAADPASADAAAKSDAAHGRAERKMIPSLRALADEERATAKKARASWQMFTIMA
EFIEATEYLSEIRPAVSIYGSARLREDSPYYQRTIDIARLFSDAGFAVISGGGPGIMEAA
NKGAHGGKSASVGLNIELPHEQQGNPYQDISMRFRHFFTRKVTFVKNSDAFIVMPGGFGT
LDELAEVLTLVQTGKSRSVPVVMFGSRFWKGLLDWFRFTLLPMGLIAEHDLDIMRIVDEP
KEALDAVYEFYEKREGVSPIPPKEEMFYL