Protein Info for RALBFv3_RS03365 in Ralstonia solanacearum IBSBF1503

Annotation: ShlB/FhaC/HecB family hemolysin secretion/activation protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 588 signal peptide" amino acids 1 to 39 (39 residues), see Phobius details PF08479: POTRA_2" amino acids 118 to 175 (58 residues), 53.2 bits, see alignment 3.3e-18 PF17287: POTRA_3" amino acids 177 to 229 (53 residues), 80.7 bits, see alignment 6.3e-27 PF03865: ShlB" amino acids 234 to 548 (315 residues), 361.7 bits, see alignment E=6.3e-112

Best Hits

Swiss-Prot: 63% identical to CDIB2_BURP2: Outer membrane transporter CdiB-2 (cdiB2) from Burkholderia pseudomallei (strain 1026b)

KEGG orthology group: None (inferred from 93% identity to rsl:RPSI07_0277)

Predicted SEED Role

"Channel-forming transporter/cytolysins activator of TpsB family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (588 amino acids)

>RALBFv3_RS03365 ShlB/FhaC/HecB family hemolysin secretion/activation protein (Ralstonia solanacearum IBSBF1503)
MKYKNKALPQALAAVGLLMLAHPIDIFAQATPAQSAAAANTEQEQRLRQQQQAREREQAV
QAPAVRAQQAAPAEYPDLPTETPCFRIDRFALEVPQDLPEAARTKGASALPQDPFAFAQT
WLGHYNGACIGKQGVEVLTKSISQAILSRGYVTTRVLLPQQDLSTGTMRFVLVPGMIGQI
RFARADVRGTWKSAFPSRPGDLLNLRDLEQGLEQMKRVASQDVDMQIVPTDVPGVSDVVI
SVKRAKPWTVVAAVDNSGTRSTGKLQGNLSLSLDNPLGLNDLFNVGYSQDLDFSNKGHGT
HGWNGFYSVPWGYWTATVSAYSSTYFQQIAGVNQTFVSSGNSQNFDVKLQRVIERSQNDV
LGAQFRLSKRFGKNFVDDTEIPQQRRNNTVVETGLTDRHYFGAAQFDGSLMLRHGVGDLG
AQDDTLADGGGPTWHYRMLVADANLSVPFKVGAQPLRYVTTFHGQFTNDHLYSIDAITIG
SRYTVRGFDGEMSLIGDRGFYWRNELQLPLGPTGQSLYGGLDYGHVYGPSTVGLAGTQLA
GAVIGLRGGWGTRAGSISYDLFLGTPVYKPVAFQTAKVTVGFQLIYQY